Structure of PDB 8sua Chain A Binding Site BS01

Receptor Information
>8sua Chain A (length=196) Species: 1762 (Mycobacteriaceae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVKGRILDAAADAFMARGFANTTIDDIADEVGATKGLIYYHFRSKFDIFL
AVYEDGMRRVRERVEPHSTAPGTGHQRLEAMSIAHLENLMTELGYHHVVH
QGVRHQDSTALKVRQRDALTALNELRRDYERMFRRVIAEGIADGSLRRVD
EALATRTLLSNLNAVDVWYRKIEGQTGEEIRELASQVVDMLIGGLA
Ligand information
Ligand IDYT9
InChIInChI=1S/C7H15BNO6/c9-7(3-10)4-14-8(15-5-7)12-1-6(11)2-13-8/h6,10-11H,1-5,9H2/q-1/t6-,7-,8-/m0/s1
InChIKeyNORKYMYNBIQBFM-FXQIFTODSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7[B-]12(OCC(CO1)O)OCC(CO2)(CO)N
ACDLabs 12.01OCC1(N)CO[B-]2(OCC(O)CO2)OC1
CACTVS 3.385N[C]1(CO)CO[B-]2(OC[CH](O)CO2)OC1
FormulaC7 H15 B N O6
Name3-azanyl-3-(hydroxymethyl)-1,5,7,11-tetraoxa-6$l^{4}-boraspiro[5.5]undecan-9-ol
ChEMBL
DrugBank
ZINC
PDB chain8sua Chain A Residue 301 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sua Structures of the DarR transcription regulator reveal unique modes of second messenger and DNA binding
Resolution1.6 Å
Binding residue
(original residue number in PDB)		M66 H94 H105 H109 R135 Y138 N172
Binding residue
(residue number reindexed from 1)		M57 H85 H96 H100 R126 Y129 N163
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 11:09:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8sua', asym_id = 'A', bs = 'BS01', title = 'Structures of the DarR transcription regulator r... unique modes of second messenger and DNA binding'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8sua', asym_id='A', bs='BS01', title='Structures of the DarR transcription regulator r... unique modes of second messenger and DNA binding')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003677', uniprot = '', pdbid = '8sua', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677', uniprot='', pdbid='8sua', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>