Structure of PDB 8sh1 Chain A Binding Site BS01

Receptor Information

>8sh1 Chain A (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNV
KLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLT
FEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCD
VQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEG
DLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSEN
QTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLT

Ligand information

>8sh1 Chain B (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgcgttagggttagggttag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8sh1 Human POT1 protects the telomeric ds-ss DNA junction by capping the 5' end of the chromosome.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	F31 K33 Y36 S38 K39 G40 D42 T48 L60 F62 Y89 Q94 S99 Y161 Y223 D224 S243 H266 G267 S270 Y271 R273
Binding residue (residue number reindexed from 1)	F26 K28 Y31 S33 K34 G35 D37 T43 L55 F57 Y84 Q89 S94 Y156 Y218 D219 S238 H261 G262 S265 Y266 R268

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043047	single-stranded telomeric DNA binding

	Biological Process
GO:0000723	telomere maintenance

	Cellular Component
GO:0000781	chromosome, telomeric region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8sh1, PDBe:8sh1, PDBj:8sh1
PDBsum	8sh1
PubMed	37590346
UniProt	Q9NUX5\|POTE1_HUMAN Protection of telomeres protein 1 (Gene Name=POT1)

[Back to BioLiP]