Structure of PDB 8sdq Chain A Binding Site BS01

Receptor Information
>8sdq Chain A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQ
PMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHR
ACALRDTAYAIIKEELDEDFEQLAEEIQESRKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sdq Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
V1013 D1020 E1062 Y1063 P1065 I1074
Binding residue
(residue number reindexed from 1)
V36 D43 E85 Y86 P88 I97
Enzymatic activity
Enzyme Commision number 3.6.1.-
External links
PDB RCSB:8sdq, PDBe:8sdq, PDBj:8sdq
PDBsum8sdq
PubMed38733345
UniProtQ6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 (Gene Name=ATAD2)

[Back to BioLiP]