Structure of PDB 8sdo Chain A Binding Site BS01

Receptor Information
>8sdo Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQP
MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA
CALRDTAYAIIKEELDEDFEQLAEEIQESR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sdo Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains.
Resolution2.01 Å
Binding residue
(original residue number in PDB)
V1013 D1020 Y1063 P1065 I1074
Binding residue
(residue number reindexed from 1)
V35 D42 Y85 P87 I96
Enzymatic activity
Enzyme Commision number 3.6.1.-
External links
PDB RCSB:8sdo, PDBe:8sdo, PDBj:8sdo
PDBsum8sdo
PubMed38733345
UniProtQ6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 (Gene Name=ATAD2)

[Back to BioLiP]