Structure of PDB 8scz Chain A Binding Site BS01

Receptor Information
>8scz Chain A (length=635) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKG
KVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENN
DIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYL
DQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIAT
VKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICK
DLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLY
TSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFE
EKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVD
ALKNWIEGNPKLSFLKPGILDHNILIATSVAQCNLVILYEYVGRARGSKC
FLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEK
FIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAF
KECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIK
IESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEM
Ligand information
>8scz Chain B (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaucgaucgaucgaucggcaucgaucggcgccgaucgaugccgaucgau
cgaucgaucc
<<<<<<<<<<<<<<<<<<<<<<<<<<<<<..>>>>>>>>>>>>>>>>>>>
>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8scz Cryo-EM structure of 14aa-GS RIG-I in complex with p3SLR30
Resolution3.4 Å
Binding residue
(original residue number in PDB)		N298 Q299 I300 S325 G326 K379 Q380 D416 K418 Q507 E510 Q511 V514 R546 K635 T636 R637 T697 S698 V718 K750 H830 F853 K861 I875 K888 K907 W908 K909
Binding residue
(residue number reindexed from 1)		N57 Q58 I59 S84 G85 K138 Q139 D175 K177 Q266 E269 Q270 V273 R305 K394 T395 R396 T428 S429 V442 K462 H542 F565 K573 I587 K600 K619 W620 K621
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003725 double-stranded RNA binding
GO:0003727 single-stranded RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0031625 ubiquitin protein ligase binding
GO:0038187 pattern recognition receptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0002230 positive regulation of defense response to virus by host
GO:0002376 immune system process
GO:0002735 positive regulation of myeloid dendritic cell cytokine production
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0009597 detection of virus
GO:0009615 response to virus
GO:0010467 gene expression
GO:0010628 positive regulation of gene expression
GO:0030334 regulation of cell migration
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032727 positive regulation of interferon-alpha production
GO:0032728 positive regulation of interferon-beta production
GO:0032755 positive regulation of interleukin-6 production
GO:0032757 positive regulation of interleukin-8 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034344 regulation of type III interferon production
GO:0039529 RIG-I signaling pathway
GO:0043330 response to exogenous dsRNA
GO:0045087 innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051607 defense response to virus
GO:0060760 positive regulation of response to cytokine stimulus
GO:0071360 cellular response to exogenous dsRNA
GO:0140374 antiviral innate immune response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005923 bicellular tight junction
GO:0015629 actin cytoskeleton
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8scz, PDBe:8scz, PDBj:8scz
PDBsum8scz
PubMed
UniProtO95786|RIGI_HUMAN Antiviral innate immune response receptor RIG-I (Gene Name=RIGI)

[Back to BioLiP]