Structure of PDB 8sc2 Chain A Binding Site BS01

Receptor Information
>8sc2 Chain A (length=453) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAE
ELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPL
GPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGY
FADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWM
AGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAV
SLPTFLFLLYYWCVPESPRSPSFADLFRTPRLRKRTFILMYLWFTDSVLY
QGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNL
LAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFV
RNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTL
LLP
Ligand information
Ligand IDC9F
InChIInChI=1S/C22H26N2O4S/c1-15(25)28-20-21(16-9-11-17(27-4)12-10-16)29-19-8-6-5-7-18(19)24(22(20)26)14-13-23(2)3/h5-12,20-21H,13-14H2,1-4H3/t20-,21+/m1/s1
InChIKeyHSUGRBWQSSZJOP-RTWAWAEBSA-N
SMILES
SoftwareSMILES
CACTVS 3.385COc1ccc(cc1)[CH]2Sc3ccccc3N(CCN(C)C)C(=O)[CH]2OC(C)=O
CACTVS 3.385COc1ccc(cc1)[C@@H]2Sc3ccccc3N(CCN(C)C)C(=O)[C@@H]2OC(C)=O
OpenEye OEToolkits 2.0.7CC(=O)O[C@@H]1[C@@H](Sc2ccccc2N(C1=O)CCN(C)C)c3ccc(cc3)OC
OpenEye OEToolkits 2.0.7CC(=O)OC1C(Sc2ccccc2N(C1=O)CCN(C)C)c3ccc(cc3)OC
FormulaC22 H26 N2 O4 S
NameDiltiazem
ChEMBLCHEMBL23
DrugBankDB00343
ZINCZINC000000621893
PDB chain8sc2 Chain A Residue 601 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sc2 Structural basis of promiscuous substrate transport by Organic Cation Transporter 1.
Resolution3.36 Å
Binding residue
(original residue number in PDB)		C36 W217 Q241 F244 W354 S358 I446
Binding residue
(residue number reindexed from 1)		C18 W199 Q223 F226 W293 S297 I385
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005277 acetylcholine transmembrane transporter activity
GO:0005326 neurotransmitter transmembrane transporter activity
GO:0005330 dopamine:sodium symporter activity
GO:0005334 norepinephrine:sodium symporter activity
GO:0005515 protein binding
GO:0008504 monoamine transmembrane transporter activity
GO:0008514 organic anion transmembrane transporter activity
GO:0015101 organic cation transmembrane transporter activity
GO:0015132 prostaglandin transmembrane transporter activity
GO:0015214 pyrimidine nucleoside transmembrane transporter activity
GO:0015234 thiamine transmembrane transporter activity
GO:0015489 putrescine transmembrane transporter activity
GO:0015606 spermidine transmembrane transporter activity
GO:0015651 quaternary ammonium group transmembrane transporter activity
GO:0019534 toxin transmembrane transporter activity
GO:0022857 transmembrane transporter activity
GO:0042802 identical protein binding
GO:0042910 xenobiotic transmembrane transporter activity
GO:1901235 (R)-carnitine transmembrane transporter activity
Biological Process
GO:0006805 xenobiotic metabolic process
GO:0006811 monoatomic ion transport
GO:0006812 monoatomic cation transport
GO:0006836 neurotransmitter transport
GO:0006837 serotonin transport
GO:0010248 establishment or maintenance of transmembrane electrochemical gradient
GO:0015695 organic cation transport
GO:0015697 quaternary ammonium group transport
GO:0015732 prostaglandin transport
GO:0015844 monoamine transport
GO:0015847 putrescine transport
GO:0015848 spermidine transport
GO:0015870 acetylcholine transport
GO:0015872 dopamine transport
GO:0015874 norepinephrine transport
GO:0015888 thiamine transport
GO:0042908 xenobiotic transport
GO:0048241 epinephrine transport
GO:0051610 serotonin uptake
GO:0051620 norepinephrine uptake
GO:0055085 transmembrane transport
GO:0071934 thiamine transmembrane transport
GO:0072237 metanephric proximal tubule development
GO:0072530 purine-containing compound transmembrane transport
GO:0090494 dopamine uptake
GO:0098655 monoatomic cation transmembrane transport
GO:0150104 transport across blood-brain barrier
GO:1902270 (R)-carnitine transmembrane transport
GO:1902616 acyl carnitine transmembrane transport
GO:1903711 spermidine transmembrane transport
GO:1990748 cellular detoxification
GO:1990962 xenobiotic transport across blood-brain barrier
Cellular Component
GO:0005886 plasma membrane
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0016328 lateral plasma membrane
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8sc2, PDBe:8sc2, PDBj:8sc2
PDBsum8sc2
PubMed37821493
UniProtO15245|S22A1_HUMAN Solute carrier family 22 member 1 (Gene Name=SLC22A1)

[Back to BioLiP]