Structure of PDB 8rzv Chain A Binding Site BS01

Receptor Information
>8rzv Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGF
GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKI
FVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHD
SVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rzv Structure of UP1 S4ES6E phosphomimetic mutant in complex with human telomeric repeat DNA
Resolution1.51 Å
Binding residue
(original residue number in PDB)		K15 F17 G19 G20 D42 V44 M46 R55 F57 F59 E85 A89 V90 R92 S95 H101
Binding residue
(residue number reindexed from 1)		K8 F10 G12 G13 D35 V37 M39 R48 F50 F52 E78 A82 V83 R85 S88 H94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8rzv, PDBe:8rzv, PDBj:8rzv
PDBsum8rzv
PubMed
UniProtP09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Gene Name=HNRNPA1)

[Back to BioLiP]