Structure of PDB 8ryk Chain A Binding Site BS01

Receptor Information
>8ryk Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGE
ESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFV
FNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQF
VSS
Ligand information
>8ryk Chain C (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FWDSWGYWYGPWDC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ryk Ligandability Assessment of IL-1 beta by Integrated Hit Identification Approaches.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
V3 R4 S5 L6 N7 S43 L62 K63 Y68 P87 K88 Y90 P91 S153
Binding residue
(residue number reindexed from 1)
V3 R4 S5 L6 N7 S43 L62 K63 Y68 P87 K88 Y90 P91 S153
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ryk, PDBe:8ryk, PDBj:8ryk
PDBsum8ryk
PubMed38728572
UniProtP01584|IL1B_HUMAN Interleukin-1 beta (Gene Name=IL1B)

[Back to BioLiP]