Structure of PDB 8rxb Chain A Binding Site BS01

Receptor Information
>8rxb Chain A (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKC
KEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPASVVVLLCRQPCASQSS
QWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxb UPF1 helicase orchestrates mutually exclusive interactions with the SMG6 endonuclease and UPF2.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L62 E68 Y70 S89 V90 V91 V92
Binding residue
(residue number reindexed from 1)		L61 E67 Y69 S85 V86 V87 V88
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0005524 ATP binding
GO:0008270 zinc ion binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxb, PDBe:8rxb, PDBj:8rxb
PDBsum8rxb
PubMed38709891
UniProtQ92900|RENT1_HUMAN Regulator of nonsense transcripts 1 (Gene Name=UPF1)

[Back to BioLiP]