Structure of PDB 8rop Chain A Binding Site BS01

Receptor Information
>8rop Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8rop Chain C (length=8) Species: 132504 (Influenza A virus (A/X-31(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEIRTFSF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rop Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix
Resolution1.15 Å
Binding residue
(original residue number in PDB)		Y7 H9 S24 R62 N63 N70 T73 Y74 E76 S77 Y84 Y99 S116 T143 K146 W147 V152 Q155 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 H9 S24 R62 N63 N70 T73 Y74 E76 S77 Y84 Y99 S116 T143 K146 W147 V152 Q155 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links