Structure of PDB 8roo Chain A Binding Site BS01

Receptor Information
>8roo Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8roo Chain B (length=8) Species: 132504 (Influenza A virus (A/X-31(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YERMCNIL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8roo Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Y7 H9 S24 E58 Y59 R62 N63 I66 N70 T73 E76 S77 N80 Y84 R97 Y99 Y123 T143 K146 W147 V152 L156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 H9 S24 E58 Y59 R62 N63 I66 N70 T73 E76 S77 N80 Y84 R97 Y99 Y123 T143 K146 W147 V152 L156 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links