Structure of PDB 8rnh Chain A Binding Site BS01

Receptor Information
>8rnh Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>8rnh Chain C (length=9) Species: 383579 (Influenza A virus (A/Memphis/18/1978(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEIEITTHF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rnh Crystal structure of HLA B*18:01 in complex with EEIEITTHF, an 9-mer epitope from Influenza A
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y7 H9 S24 R62 Q65 I66 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 Q155 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 H9 S24 R62 Q65 I66 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 Q155 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links