Structure of PDB 8qu9 Chain A Binding Site BS01

Receptor Information
>8qu9 Chain A (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKY
FLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECAL
HLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTN
LRKMGAPESGLAEYLFDKHTLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qu9 Structural basis for the intracellular regulation of ferritin degradation.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		A19 A20 N22 R23 N26 L27 Y30 F82 Q84 K87 D90 N110 V111 Q113 E117
Binding residue
(residue number reindexed from 1)		A14 A15 N17 R18 N21 L22 Y25 F77 Q79 K82 D85 N105 V106 Q108 E112
Enzymatic activity
Enzyme Commision number 1.16.3.1: ferroxidase.
Gene Ontology
Molecular Function
GO:0004322 ferroxidase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008199 ferric iron binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140315 iron ion sequestering activity
Biological Process
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006880 intracellular sequestering of iron ion
GO:0006955 immune response
GO:0008285 negative regulation of cell population proliferation
GO:0048147 negative regulation of fibroblast proliferation
GO:0110076 negative regulation of ferroptosis
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0044754 autolysosome
GO:0070062 extracellular exosome
GO:0070288 ferritin complex
GO:1904724 tertiary granule lumen
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qu9, PDBe:8qu9, PDBj:8qu9
PDBsum8qu9
PubMed38714719
UniProtP02794|FRIH_HUMAN Ferritin heavy chain (Gene Name=FTH1)

[Back to BioLiP]