Structure of PDB 8qtf Chain A Binding Site BS01

Receptor Information
>8qtf Chain A (length=234) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYK
NVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGI
LKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLA
AYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFD
EAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qtf Mechanistic insights into the function of 14-3-3 proteins as negative regulators of brassinosteroid signaling.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
K53 R60 R133 Y134 L178 N179 V182 E186 N230 W234
Binding residue
(residue number reindexed from 1)
K50 R57 R130 Y131 L175 N176 V179 E183 N227 W231
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009742 brassinosteroid mediated signaling pathway
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8qtf, PDBe:8qtf, PDBj:8qtf
PDBsum8qtf
PubMed38783418
UniProtQ01525|14332_ARATH 14-3-3-like protein GF14 omega (Gene Name=GRF2)

[Back to BioLiP]