Structure of PDB 8qjk Chain A Binding Site BS01

Receptor Information
>8qjk Chain A (length=82) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKT
PKFGENLLKIIKSKGSQSFIVDCTDEEIDQFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qjk A cyclic-nucleotide binding membrane protein provides CRISPR-mediated antiphage defence in Vibrio cholera
Resolution1.761 Å
Binding residue
(original residue number in PDB)		R95 A96 L99 G100 R110 F111
Binding residue
(residue number reindexed from 1)		R27 A28 L31 G32 R42 F43
External links