Structure of PDB 8qfz Chain A Binding Site BS01

Receptor Information
>8qfz Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLT
EIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINTTNKCLEQ
VSQLQGLWRRFNRPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qfz Discovery and Characterization of a Bicyclic Peptide (Bicycle) Binder to Thymic Stromal Lymphopoietin.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		A42 T46 M100 K101 K103 A104
Binding residue
(residue number reindexed from 1)		A15 T19 M73 K74 K76 A77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005139 interleukin-7 receptor binding
Biological Process
GO:0001961 positive regulation of cytokine-mediated signaling pathway
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0008284 positive regulation of cell population proliferation
GO:0019221 cytokine-mediated signaling pathway
GO:0032722 positive regulation of chemokine production
GO:0032733 positive regulation of interleukin-10 production
GO:0032736 positive regulation of interleukin-13 production
GO:0032754 positive regulation of interleukin-5 production
GO:0032755 positive regulation of interleukin-6 production
GO:0033005 positive regulation of mast cell activation
GO:0038111 interleukin-7-mediated signaling pathway
GO:0043066 negative regulation of apoptotic process
GO:0050729 positive regulation of inflammatory response
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071654 positive regulation of chemokine (C-C motif) ligand 1 production
GO:0071657 positive regulation of granulocyte colony-stimulating factor production
GO:1904894 positive regulation of receptor signaling pathway via STAT
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qfz, PDBe:8qfz, PDBj:8qfz
PDBsum8qfz
PubMed38284169
UniProtQ969D9|TSLP_HUMAN Thymic stromal lymphopoietin (Gene Name=TSLP)

[Back to BioLiP]