Structure of PDB 8q7i Chain A Binding Site BS01

Receptor Information
>8q7i Chain A (length=257) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMALEARLEQASILKKVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALV
SMMLKAEGFSPYRCDRNIALGVNLTSLTKVLRAAQNEDILTLKAEDAPDV
LNLVFESSETDRISEYDLKLMDIDQEHLGIPETEYAATITMPSNEFKRIT
TDLMAMSESVTIEANKDGVKFSCQGDIGNGSVTLRQHTNVEKPNESIEIE
LSEPVSLTFSLKYLVNFCKASALSNTVKICLSNEVPLLVEYSLGGSSYLR
FYLAPKI
Ligand information
>8q7i Chain P (length=12) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QQARIEGFFKVI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7i Canonical binding of Chaetomium thermophilum DNA polymerase delta/zeta subunit PolD3 and flap endonuclease Fen1 to PCNA
Resolution1.95 Å
Binding residue
(original residue number in PDB)		M40 H44 V45 H125 L126 G127 E232 P234 A252 P253 K254 I255
Binding residue
(residue number reindexed from 1)		M42 H46 V47 H127 L128 G129 E234 P236 A254 P255 K256 I257
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0019985 translesion synthesis
Cellular Component
GO:0005634 nucleus
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7i, PDBe:8q7i, PDBj:8q7i
PDBsum8q7i
PubMed38223238
UniProtG0SF70|PCNA_CHATD Proliferating cell nuclear antigen (Gene Name=CTHT_0061010)

[Back to BioLiP]