Structure of PDB 8q5s Chain A Binding Site BS01

Receptor Information
>8q5s Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTD
GQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKL
GSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAK
VSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAIT
VWYFDADERARAKVKYLTG
Ligand information
>8q5s Chain B (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELDLETLAPYIPMDGEDFQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q5s HIF prolyl hydroxylase 2 in complex with HIF2alpha-CODD
Resolution1.49 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 I251 R252 W258 D277 R281 N293 G294 R295 Y310 H313 V314 D315 P317 N318 R322 R370 W389 F391 R396 K400 Y403
Binding residue
(residue number reindexed from 1)		Q52 L53 V54 S55 I64 R65 W71 D90 R94 N106 G107 R108 Y123 H126 V127 D128 P130 N131 R135 R183 W202 F204 R209 K213 Y216
External links
PDB RCSB:8q5s, PDBe:8q5s, PDBj:8q5s
PDBsum8q5s
PubMed
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]