Structure of PDB 8q5p Chain A Binding Site BS01

Receptor Information
>8q5p Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTEMQCECTPLSKD
ERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILT
EKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFM
ALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVP
SGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q5p Structural and enzymatic evidence for the methylation of the ACK1 tyrosine kinase by the histone lysine methyltransferase SETD2.
Resolution1.814 Å
Binding residue
(original residue number in PDB)		M1526 F1589 A1597 Y1604 F1606 M1607 A1608 T1637 Q1638 K1639 Y1666 Q1667 F1668 Q1669 R1670 Y1671 G1672 K1673 E1674 A1700
Binding residue
(residue number reindexed from 1)		M69 F132 A140 Y147 F149 M150 A151 T180 Q181 K182 Y209 Q210 F211 Q212 R213 Y214 G215 K216 E217 A243
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q5p, PDBe:8q5p, PDBj:8q5p
PDBsum8q5p
PubMed38160530
UniProtQ9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)

[Back to BioLiP]