Structure of PDB 8pw0 Chain A Binding Site BS01

Receptor Information
>8pw0 Chain A (length=137) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLSPSAEDYLKHLYGLGQSGKVSTQALAAALGVAPASVTGMLRKLTEQGL
VSHAPYQGARLTAEGERVALEVLRHHRLLELFLHRALGVPLDEVHDEAEA
LEHALSERLEARIAAWLGDPTHDPHGDPIPTLEGELP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pw0 Metal ion activation and DNA recognition by the Deinococcus radiodurans manganese sensor DR2539.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		T27 Q28 P38 A39 T42 H56 Y59
Binding residue
(residue number reindexed from 1)		T24 Q25 P35 A36 T39 H53 Y56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8pw0, PDBe:8pw0, PDBj:8pw0
PDBsum8pw0
PubMed38652591
UniProtQ9RRF3

[Back to BioLiP]