Structure of PDB 8pnt Chain A Binding Site BS01

Receptor Information
>8pnt Chain A (length=749) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTV
ARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAV
YLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLS
SLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQ
EEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPP
HTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSH
WKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTL
LIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQ
FRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSA
LCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVP
NPNSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKL
HVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTR
LFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDRKDGVLEEQ
IERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYK
NCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA
Ligand information
>8pnt Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KINNIWGAVLQEQNQDAVAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pnt Structural basis for competitive binding of productive and degradative co-transcriptional effectors to the nuclear cap-binding complex.
Resolution3.46 Å
Binding residue
(original residue number in PDB)		Q389 H420 F424 R427 W428 S429
Binding residue
(residue number reindexed from 1)		Q364 H395 F399 R402 W403 S404
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000245 spliceosomal complex assembly
GO:0000380 alternative mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0002191 cap-dependent translational initiation
GO:0006370 7-methylguanosine mRNA capping
GO:0006401 RNA catabolic process
GO:0006406 mRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0008334 histone mRNA metabolic process
GO:0008380 RNA splicing
GO:0016070 RNA metabolic process
GO:0016071 mRNA metabolic process
GO:0030307 positive regulation of cell growth
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031053 primary miRNA processing
GO:0031124 mRNA 3'-end processing
GO:0031442 positive regulation of mRNA 3'-end processing
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195 miRNA-mediated post-transcriptional gene silencing
GO:0042789 mRNA transcription by RNA polymerase II
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0050684 regulation of mRNA processing
GO:0051028 mRNA transport
GO:0051607 defense response to virus
GO:1905216 positive regulation of RNA binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005846 nuclear cap binding complex
GO:0034518 RNA cap binding complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pnt, PDBe:8pnt, PDBj:8pnt
PDBsum8pnt
PubMed38175753
UniProtQ09161|NCBP1_HUMAN Nuclear cap-binding protein subunit 1 (Gene Name=NCBP1)

[Back to BioLiP]