Structure of PDB 8pna Chain A Binding Site BS01

Receptor Information
>8pna Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQV
KTWYQNRRTKWKRQTAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pna transcription factor BARHL2 bound to different DNA sequences
Resolution1.45 Å
Binding residue
(original residue number in PDB)		R233 K234 A235 R236 T237 F239 N282 K286
Binding residue
(residue number reindexed from 1)		R7 K8 A9 R10 T11 F13 N56 K60
External links
PDB RCSB:8pna, PDBe:8pna, PDBj:8pna
PDBsum8pna
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]