Structure of PDB 8pmf Chain A Binding Site BS01

Receptor Information
>8pmf Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVK
TWYQNRRTKWKRQTAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pmf transcription factor BARHL2 bound to DNA sequences
Resolution0.95 Å
Binding residue
(original residue number in PDB)		K231 R233 R236 T237 F239 N282 K286
Binding residue
(residue number reindexed from 1)		K4 R6 R9 T10 F12 N55 K59
External links
PDB RCSB:8pmf, PDBe:8pmf, PDBj:8pmf
PDBsum8pmf
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]