Structure of PDB 8pm7 Chain A Binding Site BS01

Receptor Information
>8pm7 Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWY
QNRRTKWKRQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pm7 transcription factor BARHL2 bound to DNA sequences
Resolution1.7 Å
Binding residue
(original residue number in PDB)		R233 K234 A235 R236 T237 F239 N282 K286
Binding residue
(residue number reindexed from 1)		R3 K4 A5 R6 T7 F9 N52 K56
External links
PDB RCSB:8pm7, PDBe:8pm7, PDBj:8pm7
PDBsum8pm7
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]