Structure of PDB 8pjg Chain A Binding Site BS01

Receptor Information

>8pjg Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD

Ligand information

>8pjg Chain C (length=13) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PKYVKQNTLKLAR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8pjg A targeted single mutation in influenza A virus universal epitope transforms immunogenicity and protective immunity via CD4 + T cell activation.
Resolution	1.83 Å
Binding residue (original residue number in PDB)	Q9 E11 A52 S53 F54 G58 N62 V65 D66 N69 I72 M73
Binding residue (residue number reindexed from 1)	Q7 E9 A50 S51 F52 G56 N60 V63 D64 N67 I70 M71

External links

PDB	RCSB:8pjg, PDBe:8pjg, PDBj:8pjg
PDBsum	8pjg
PubMed	38819988
UniProt	P01903\|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]