Structure of PDB 8pii Chain A Binding Site BS01

Receptor Information
>8pii Chain A (length=111) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGGVFVQSGGSLRLSCAASGATSTFDGMGWFRQAPGKEKEFVSAISYEQG
SYTYYADSVKGRFTISRDNSKNMVYLQMNSLRAEDTATYYCAPAYEGDLY
AFQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pii VHH Z70 mutant 3 in interaction with PHF6 Tau peptide
Resolution2.35 Å
Binding residue
(original residue number in PDB)		K47 F49 Y62 E104 D106 L107 Y108 A109 F110
Binding residue
(residue number reindexed from 1)		K39 F41 Y54 E96 D98 L99 Y100 A101 F102
External links