Structure of PDB 8pi7 Chain A Binding Site BS01

Receptor Information
>8pi7 Chain A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGL
NQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGNRFKWGPA
SQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLV
TEVRVYNWFANRRKEEAF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pi7 Molecular mechanism of HNF-1A-mediated HNF4A gene regulation and promoter-driven HNF4A-MODY diabetes.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		P129 Q130 R131 Q141 S142 S145 Q146 N149 K205 Y265 R272 K273
Binding residue
(residue number reindexed from 1)		P40 Q41 R42 Q52 S53 S56 Q57 N60 K96 Y156 R163 K164
External links
PDB RCSB:8pi7, PDBe:8pi7, PDBj:8pi7
PDBsum8pi7
PubMed38855865
UniProtP20823|HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha (Gene Name=HNF1A)

[Back to BioLiP]