Structure of PDB 8pch Chain A Binding Site BS01

Receptor Information
>8pch Chain A (length=220) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLA
EQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCK
FQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKG
IYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLI
ERGKNMCGLAACASYPIPLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pch Crystal structure of porcine cathepsin H determined at 2.1 A resolution: location of the mini-chain C-terminal carboxyl group defines cathepsin H aminopeptidase function.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G66 L67 S69 A133 P155C D155D V157 N158 C205 A206
Binding residue
(residue number reindexed from 1)		G69 L70 S72 A137 P161 D162 V164 N165 C212 A213
Enzymatic activity
Catalytic site (original residue number in PDB) Q19 C25 H159 N175
Catalytic site (residue number reindexed from 1) Q20 C26 H166 N186
Enzyme Commision number 3.4.22.16: cathepsin H.
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8pch, PDBe:8pch, PDBj:8pch
PDBsum8pch
PubMed9493267
UniProtO46427|CATH_PIG Pro-cathepsin H (Gene Name=CTSH)

[Back to BioLiP]