Structure of PDB 8p9r Chain A Binding Site BS01

Receptor Information
>8p9r Chain A (length=74) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTV
DYETLMKVMDTLHQAGYLKIGLVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p9r Ton Motor Conformational Switch and Peptidoglycan Role in Bacterial Nutrient Uptake.
Resolution1.52 Å
Binding residue
(original residue number in PDB)		F103 I130 G131 L132
Binding residue
(residue number reindexed from 1)		F43 I70 G71 L72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0022857 transmembrane transporter activity
Biological Process
GO:0055085 transmembrane transport

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8p9r, PDBe:8p9r, PDBj:8p9r
PDBsum8p9r
PubMed38184686
UniProtP0ABV2|EXBD_ECOLI Biopolymer transport protein ExbD (Gene Name=exbD)

[Back to BioLiP]