Structure of PDB 8p7c Chain A Binding Site BS01

Receptor Information
>8p7c Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSQKLT
MLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKV
FQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPG
KSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFM
DTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPK
Ligand information
>8p7c Chain R (length=83) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcagugguggccgagugguuaaggcgucggacuugaaauccgauucgcuc
ugcgagcguggguucgaaucccacccacugcgc
<<<<<<<..<<<..........>>><<<<<<.......>>>>>><<<<..
.>>>>..<<<<<.......>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p7c Structural basis of the cooperation between the m3C-RNA-methyltransferase METTL6 with SerRS amino-acyl-synthetase for tRNA recognition
Resolution3.7 Å
Binding residue
(original residue number in PDB)		K43 L47 K50 F56 F57 K58 H61 R114 Y190 H195 R199 R213 Q214 N250 K252 R259
Binding residue
(residue number reindexed from 1)		K17 L21 K24 F30 F31 K32 H35 R82 Y158 H163 R167 R181 Q182 N218 K220 R227
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008173 RNA methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0019899 enzyme binding
GO:0052735 tRNA (cytidine-3-)-methyltransferase activity
Biological Process
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p7c, PDBe:8p7c, PDBj:8p7c
PDBsum8p7c
PubMed38918637
UniProtQ8TCB7|METL6_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL6 (Gene Name=METTL6)

[Back to BioLiP]