Structure of PDB 8p43 Chain A Binding Site BS01

Receptor Information
>8p43 Chain A (length=277) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRAR
WIEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSNDESHTLQWMYG
CDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTANDIASQISKHKSEAV
DEAHQQRAYLQGPCVEWLHRYLRLGNETLQRSDPPKAHVTHHPRSEDEVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWAAVVVP
LGKEQYYTCHVYHEGLPEPLTLRWEPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p43 MHC-E is a convergent checkpoint ligand for LILRB1 on macrophages and during inflammation for NKG2A on lymphocytes
Resolution2.43 Å
Binding residue
(original residue number in PDB)		Y7 M45 E63 K66 M70 F74 N77 Y84 L95 W97 Y99 S143 K146 E152 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 M45 E63 K66 M70 F74 N77 Y84 L95 W97 Y99 S143 K146 E152 Q155 Y159 W167 Y171
External links