Structure of PDB 8p0y Chain A Binding Site BS01

Receptor Information
>8p0y Chain A (length=66) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDWPRRVKTNKGREFMFPTDLLHRTPPQVLLDALVNEYESPLSATELSDD
WPEMTFEERKNVAFNL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8p0y Structural Insights on the Nucleoprotein C-terminal domain of Mengla Virus (MLAV)
Resolution4.12 Å
Binding residue
(original residue number in PDB)		R636 R637 V638 K639 F695
Binding residue
(residue number reindexed from 1)		R5 R6 V7 K8 F64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019074 viral RNA genome packaging
Cellular Component
GO:0019013 viral nucleocapsid

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p0y, PDBe:8p0y, PDBj:8p0y
PDBsum8p0y
PubMed37888996
UniProtA0A1Q1NMU1

[Back to BioLiP]