Structure of PDB 8ow4 Chain A Binding Site BS01

Receptor Information
>8ow4 Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQ
LHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITVTTTSYEKIVGNTK
VLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFR
VHIPESRIVSLQTASNPIECSQRSAHELPMVERQDILTGQNFESKVVFTE
WEMEATVSPVKVNFYVINGKRSQPQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow4 2.75 angstrom crystal structure of human NFAT1 with bound DNA
Resolution2.75 Å
Binding residue
(original residue number in PDB)
R421 G428 S429 R430 G431 I479 R537 Q571
Binding residue
(residue number reindexed from 1)
R27 G34 S35 R36 G37 I85 R140 Q172
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8ow4, PDBe:8ow4, PDBj:8ow4
PDBsum8ow4
PubMed
UniProtQ13469|NFAC2_HUMAN Nuclear factor of activated T-cells, cytoplasmic 2 (Gene Name=NFATC2)

[Back to BioLiP]