Structure of PDB 8ots Chain A Binding Site BS01

Receptor Information
>8ots Chain A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8ots Chain I (length=127) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctttgttatgcaaatcggggtggggcgtcgtagacagctctagcaccgct
taaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattac
tccctagtctccaggcacgtgtcagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ots Cooperation between bHLH transcription factors and histones for DNA access.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R72 R83 F84 V117 M120
Binding residue
(residue number reindexed from 1)		R33 R44 F45 V78 M81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ots, PDBe:8ots, PDBj:8ots
PDBsum8ots
PubMed37407816
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]