Structure of PDB 8opi Chain A Binding Site BS01

Receptor Information
>8opi Chain A (length=113) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGGVFVQSGGSLRLSCAASGATSTFDGMGWFRQAPGKEREFVSAISYEQ
GSYTYYADSVKGRFTISRDNSKNMVYLQMNSLRAEDTATYYCAPAYEGDL
YAFDQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8opi VHH Z70 mutant 1 in interaction with PHF6 Tau peptide
Resolution1.83 Å
Binding residue
(original residue number in PDB)		R47 F49 Y62 G105 D106 L107 Y108 A109
Binding residue
(residue number reindexed from 1)		R40 F42 Y55 G98 D99 L100 Y101 A102
External links