Structure of PDB 8op0 Chain A Binding Site BS01

Receptor Information
>8op0 Chain A (length=114) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGGVFVQSGGSLRLSCAASGATSTFDGMGWFRQAPGKEKEFVSAISYEQ
GSYTYYADSVKGRFTISRDNSKNMVYLQMNSLRAEDTATYYCAPAYEGDL
YAFDEQGTQVTVSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8op0 VHH Z70 mutant 20 in interaction with PHF6 Tau peptide
Resolution1.54 Å
Binding residue
(original residue number in PDB)		F49 Y62 E104 G105 D106 L107 Y108 A109 F110
Binding residue
(residue number reindexed from 1)		F42 Y55 E97 G98 D99 L100 Y101 A102 F103
External links