Structure of PDB 8okd Chain A Binding Site BS01

Receptor Information

>8okd Chain A (length=291) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KRAFDFSAHGRRHVALRIAYMGWGYQGFASQENTNNTIEEKLFEALTKTR
LVESRQTSNYHRCGRTAKGVSAFGQVISLDLRSQFPEEIRYTHILNRVLP
PDIRILAWAPVEPSFSARFSCLERTYRYFFPRADLDIVTMDYAAQKYVGT
HDFRNLCKMDVANGVINFQRTILSAQVQLVQEPFQLCQFEVTGQAFLYHQ
VRCMMAILFLIGQGMEKPEIIDELLNIEKNPQKPQYSMAVEFPLVLYDCK
FENVKWIYDQEAQEFNITHLQQLWANHAVKTHMLYSMLQGL

Ligand information

>8okd Chain C (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggccccaugguguaaugguuagcacucuggacauccagcgauccgaguuc
aaaucucggugggaccucca

<<.<<<<..<<<<........>>>>.<<<<<..>>>>>....<<<<<...
....>>>>>>>>>.>>....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8okd The molecular basis of tRNA selectivity by human pseudouridine synthase 3.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	K52 R53 K99 R101 R166 F343
Binding residue (residue number reindexed from 1)	K1 R2 K48 R50 R97 F265

Gene Ontology

	Molecular Function
GO:0009982	pseudouridine synthase activity
GO:0016853	isomerase activity
GO:0160154	tRNA pseudouridine(38/39) synthase activity

	Biological Process
GO:0006400	tRNA modification
GO:0008033	tRNA processing
GO:0031119	tRNA pseudouridine synthesis
GO:1990481	mRNA pseudouridine synthesis

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8okd, PDBe:8okd, PDBj:8okd
PDBsum	8okd
PubMed	38996458
UniProt	Q9BZE2\|PUS3_HUMAN tRNA pseudouridine(38/39) synthase (Gene Name=PUS3)

[Back to BioLiP]