Structure of PDB 8kcc Chain A Binding Site BS01

Receptor Information
>8kcc Chain A (length=102) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEVLE
LAGNAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNINSV
LL
Ligand information
>8kcc Chain I (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcctggagaatcccggtgccgaggccgctcaattggtcgtagacagctc
tagcaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgcca
aggggattactccctagtctccaggcacgtgtcacatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcc Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S25 K26 R38 R41 R51 R86
Binding residue
(residue number reindexed from 1)		S2 K3 R15 R18 R28 R63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
Biological Process
GO:0070828 heterochromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005730 nucleolus
GO:0009506 plasmodesma
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kcc, PDBe:8kcc, PDBj:8kcc
PDBsum8kcc
PubMed38870940
UniProtQ9FJE8|H2A7_ARATH Probable histone H2A.7 (Gene Name=At5g59870)

[Back to BioLiP]