Structure of PDB 8kcb Chain A Binding Site BS01

Receptor Information
>8kcb Chain A (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLEL
AGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIAN
Ligand information
>8kcb Chain I (length=126) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccggtgccgaggccgctcaattggtcgtagacagctctagcaccgctta
aacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactc
cctagtctccaggcacgtgtcacata
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kcb Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
Resolution3.17 Å
Binding residue
(original residue number in PDB)		R18 G29 R30 R33 R43 R78
Binding residue
(residue number reindexed from 1)		R2 G13 R14 R17 R27 R62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0009294 DNA-mediated transformation
GO:0009611 response to wounding
GO:0009617 response to bacterium
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kcb, PDBe:8kcb, PDBj:8kcb
PDBsum8kcb
PubMed38870940
UniProtQ9LD28|H2A6_ARATH Histone H2A.6 (Gene Name=RAT5)

[Back to BioLiP]