Structure of PDB 8k4l Chain A Binding Site BS01

Receptor Information
>8k4l Chain A (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSTAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQT
RLLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKY
KSMILEDLESALAENSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYST
GRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVK
NCYKQHGREDLLYAFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k4l Crystal structure of NRF1 homodimer in complex with DNA
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P210 K221 P222 G223 W224 N242 R244
Binding residue
(residue number reindexed from 1)		P143 K154 P155 G156 W157 N175 R177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8k4l, PDBe:8k4l, PDBj:8k4l
PDBsum8k4l
PubMed38055835
UniProtQ16656|NRF1_HUMAN Nuclear respiratory factor 1 (Gene Name=NRF1)

[Back to BioLiP]