Structure of PDB 8k3d Chain A Binding Site BS01

Receptor Information
>8k3d Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEVNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKES
CKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDL
LYAFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k3d Crystal structure of NRF1 DBD bound to DNA
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q202 R206 G220 K221 R244 S245 D246
Binding residue
(residue number reindexed from 1)		Q24 R28 G42 K43 R66 S67 D68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8k3d, PDBe:8k3d, PDBj:8k3d
PDBsum8k3d
PubMed38055835
UniProtQ16656|NRF1_HUMAN Nuclear respiratory factor 1 (Gene Name=NRF1)

[Back to BioLiP]