Structure of PDB 8k28 Chain A Binding Site BS01

Receptor Information
>8k28 Chain A (length=173) Species: 979527 (Vibrio phage ICP1_2004_A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKEMIEDFISKGGLIFTHSGRYTNTNNSCFIFNKNDIGVDTKVDMYTPKS
AGIKNEEGENLWQVLNKANMFYRIYSGELGEELQYLLKSCCTAKEDVTTL
PQIYFKNGEGYDILVPIGNAHNLISGTEYLWEHKYYNTFTQKLGGSNPQN
CTHACNKMRGGFKQFNCTPPQVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k28 Structure of csy complex with long DNA State1
Resolution3.54 Å
Binding residue
(original residue number in PDB)		R22 T26 N27 Y47 K50 G146 S147 N148 Q150 N151
Binding residue
(residue number reindexed from 1)		R21 T25 N26 Y46 K49 G145 S146 N147 Q149 N150
External links