Structure of PDB 8jzy Chain A Binding Site BS01

Receptor Information
>8jzy Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITPPRYRLLMSDGLNTLS
SFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKS
AEAVGVKIGNPVPYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jzy Structural characterization of human RPA70N association with DNA damage response proteins.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		N29 R31 I33 R43 L45 S54 S55 F56 M57 R91
Binding residue
(residue number reindexed from 1)		N29 R31 I33 R39 L41 S50 S51 F52 M53 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jzy, PDBe:8jzy, PDBj:8jzy
PDBsum8jzy
PubMed37668474
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]