Structure of PDB 8jzv Chain A Binding Site BS01

Receptor Information
>8jzv Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITPPRYRLLMSDGLNTLS
SFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKS
AEAVGVKIGNPVPYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jzv Structural characterization of human RPA70N association with DNA damage response proteins.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		R31 I33 R41 R43 S55 M57 N85 L87 R91 V93
Binding residue
(residue number reindexed from 1)		R31 I33 R37 R39 S51 M53 N81 L83 R87 V89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jzv, PDBe:8jzv, PDBj:8jzv
PDBsum8jzv
PubMed37668474
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]