Structure of PDB 8jzd Chain A Binding Site BS01

Receptor Information
>8jzd Chain A (length=166) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIELVIVSRLLEYPDAALWQHQQEMFEAIAASKNLPKEDAHALGIFLRDL
TTMDPLDAQAQYSELFDRGRATSLLLFEHVHGESRDRGQAMVDLLAQYEQ
HGLQLNSRELPDHLPLYLEYLAQLPQSEAVEGLKDIAPILALLSARLQQR
ESRYAVLFDLLLKLAN
Ligand information
>8jzd Chain B (length=13) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKFLDRFRYFKQK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jzd Complementary hydrophobic interaction of the redox enzyme maturation protein NarJ with the signal peptide of the respiratory nitrate reductase NarG.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		R9 E12 H21 E24 Y98 G102 L103 Q104 N106 S107 L116 E119 Q123
Binding residue
(residue number reindexed from 1)		R9 E12 H21 E24 Y98 G102 L103 Q104 N106 S107 L116 E119 Q123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0051131 chaperone-mediated protein complex assembly

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8jzd, PDBe:8jzd, PDBj:8jzd
PDBsum8jzd
PubMed38262549
UniProtP0AF26|NARJ_ECOLI Nitrate reductase molybdenum cofactor assembly chaperone NarJ (Gene Name=narJ)

[Back to BioLiP]