Structure of PDB 8jyq Chain A Binding Site BS01

Receptor Information

>8jyq Chain A (length=169) Species: 10090 (Mus musculus)

QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWL
AHIFWDDDKRYNPSLKSRLTISKDTSRNKVFLKITSVDTADTATYYCARR
VVATDWYFDVWGAGTTVTVCSGSDYEFLKSWTVEDLQKRLLALDPMMEQE
IEEIRQKYQSKRQPILDAI

Ligand information

>8jyq Chain C (length=8) Species: 9606 (Homo sapiens)

MPIWKFPD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8jyq Locally misfolded HER2 expressed on cancer cells is a promising target for development of cancer-specific antibodies
• Resolution: 1.75 Å
• Binding residue (original residue number in PDB): G31B F52 W53 D54 D56 R58 R95 V97 A98 T99 W100A
• Binding residue (residue number reindexed from 1): G33 F54 W55 D56 D58 R60 R100 V102 A103 T104 W106

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 07:32:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8jyq', asym_id = 'A', bs = 'BS01', title = 'Locally misfolded HER2 expressed on cancer cells...get for development of cancer-specific antibodies'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8jyq', asym_id='A', bs='BS01', title='Locally misfolded HER2 expressed on cancer cells...get for development of cancer-specific antibodies')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004674,0007165,0051262', uniprot = '', pdbid = '8jyq', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004674,0007165,0051262', uniprot='', pdbid='8jyq', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>