Structure of PDB 8jy0 Chain A Binding Site BS01

Receptor Information
>8jy0 Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
V
Ligand information
>8jy0 Chain B (length=64) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaccuccgcccauugcacuccgggcggugaaggagaggcgcaagguuaa
ccgccucagguucc
<<<<<<<<<<<<..........>>>>>>.......<<<<<<.........
.>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jy0 Structural mechanisms for binding and activation of a contact-quenched fluorophore by RhoBAST.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K23 D24 K27 K28 H31 Q39 S46 L49 K50 M51 R52 Q54 F56 K80 Q85 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y12 N14 N15 E18 K22 D23 K26 K27 H30 Q38 S45 L48 K49 M50 R51 Q53 F55 K79 Q84 A86 K87 T88 D89 S90 D91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8jy0, PDBe:8jy0, PDBj:8jy0
PDBsum8jy0
PubMed38760339
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]