Structure of PDB 8jug Chain A Binding Site BS01

Receptor Information

>8jug Chain A (length=162) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLH
FRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFD
EDERWTDGSSLGINFLYAATHQLGHSLGMGHSSDPNAVMYPTYNFKLSQD
DIKGIQKLYGKR

Ligand information

>8jug Chain C (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

EGFV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8jug Structure-Based Optimization and Biological Evaluation of Potent and Selective MMP-7 Inhibitors for Kidney Fibrosis.
Resolution	1.3 Å
Binding residue (original residue number in PDB)	F98 Y167 T175 L176 A177 H178 A179 F180 A211 H214 Q215 H218 H224 P234
Binding residue (residue number reindexed from 1)	F5 Y74 T82 L83 A84 H85 A86 F87 A118 H121 Q122 H125 H131 P141

Enzymatic activity

Enzyme Commision number

3.4.24.23: matrilysin.

Gene Ontology

	Molecular Function
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jug, PDBe:8jug, PDBj:8jug
PDBsum	8jug
PubMed	37861435
UniProt	P09237\|MMP7_HUMAN Matrilysin (Gene Name=MMP7)

[Back to BioLiP]