Structure of PDB 8joz Chain A Binding Site BS01

Receptor Information
>8joz Chain A (length=257) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLD
AGGGEGQTAIKMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHC
AAQDVASHLETPVDLILFHAVLEWVADPRSVLQTLWSVLRPGGVLSLMFY
NAHGLLMHNMVAGNFDYVQAGMPKKKKRTLSPDYPRDPAQVYLWLEEAGW
QIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEPYITLGRYIHV
TARKPQS
Ligand information
>8joz Chain B (length=88) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaguguggccgagcgguugaaggcaccggucuugaaaaccggcgaccc
gaaaggguuccagaguucgaaucucugcgcuuccgcca
<<<<<<<..<<<...........>>>.<<<<<.......>>>>>.<<<<<
....>>>>>.<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8joz Structural basis for the selective methylation of 5-carboxymethoxyuridine in tRNA modification.
Resolution2.22 Å
Binding residue
(original residue number in PDB)		K12 F13 N16 I17 K22 R26 A120 W124 Y150 H158 N159 A162 N164 Y167 K176 K177 R178 L180 S181 R209 K218 R246 Y247
Binding residue
(residue number reindexed from 1)		K12 F13 N16 I17 K22 R26 A120 W124 Y150 H158 N159 A162 N164 Y167 K176 K177 R178 L180 S181 R209 K218 R246 Y247
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0008168 methyltransferase activity
GO:0097697 tRNA (5-carboxymethoxyuridine(34)-5-O)-methyltransferase activity
Biological Process
GO:0002098 tRNA wobble uridine modification
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0030488 tRNA methylation
GO:0032259 methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8joz, PDBe:8joz, PDBj:8joz
PDBsum8joz
PubMed37587716
UniProtP36566|CMOM_ECOLI tRNA 5-carboxymethoxyuridine methyltransferase (Gene Name=cmoM)

[Back to BioLiP]