Structure of PDB 8jow Chain A Binding Site BS01

Receptor Information
>8jow Chain A (length=227) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLMESGGRLVTPGTPLTLTCTASDISTYSISWVRQAPGKGLEWIGHIGSS
GTQYYASWAKGRFAISRASTTVDLRITGPTTEDTATYFCARRGVGYNLYY
NMWGPGTLVTVSLGAIDMTQTPSPVSAAVGGTVTINCQASQSVYNSKNLA
WYQQKPGQPPKLLIYDSSTLASGVSSRFRGSGSGTQFTLTISGVQSDDAA
TYYCQGEFSCSSGDCAGFGGGTEVVVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8jow Origin of high binding affinity and selectivity of phosphorylated epitope-specific rabbit antibodies
Resolution1.4 Å
Binding residue
(original residue number in PDB)		G52 S53 Y58 R95 R96 G97 V98 G99 Y100 L102 Y162 E225 F226 S227 C228
Binding residue
(residue number reindexed from 1)		G48 S49 Y54 R91 R92 G93 V94 G95 Y96 L98 Y144 E207 F208 S209 C210
External links